Scaffold Ga0226836_10076142

Overview

Basic Information

• Taxon OID: 3300021792
• Scaffold ID: Ga0226836_10076142
• Source Dataset Name: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1796
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location

• Location Name: Illium vent field, Mariana back arc basin
• Coordinates
  • Lat. (^o): 18.21359
  • Long. (^o): 144.70748
  • Depth (m): 3582.53

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056142	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0226836_100761422	F056142	GGAG	LPTEIHDCRQVVENLTPTDIFRWETAVSISKMVPVKNVENTVNAVLAAHSLEALVDEEGFAQKAYIEFHDDKLDFKPNFRRITIYTYHPKWIPMPEGAEPIGYEVAYQLSRQPW