NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0226832_10122521

Scaffold Ga0226832_10122521


Overview

Basic Information
Taxon OID3300021791 Open in IMG/M
Scaffold IDGa0226832_10122521 Open in IMG/M
Source Dataset NameHydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)968
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina → unclassified Nitrospina → Nitrospina sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location
Location NameDaikoku vent field, Mariana back arc basin
CoordinatesLat. (o)21.3250983Long. (o)144.19162955Alt. (m)Depth (m)409.13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002453Metagenome / Metatranscriptome558Y
F076479Metagenome118Y
F105323Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0226832_101225211F076479AGTAGGMSFTAFILFGHICLAIPDDFDKCWNIYNKPQIHYSSERICMKAANDYLHGAQLYYKRQELSVSEIELYCIGVNPINQI
Ga0226832_101225212F002453AGAAGGMAPIESPILYDSWYECSRAAHQESISIMSKMGYKAVNDYQIGTKYHCKSVDTY
Ga0226832_101225213F105323N/AMKLKSKSSLFHTIIGRVDQQLASIPLTDSQGTPLEDSTDFDMHVDAIKEMKLTNAAGTIVHPFSTTIATQLVYDELAERREQSNGDKWHE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.