Scaffold Ga0194061_1107216

Overview

Basic Information

• Taxon OID: 3300021601
• Scaffold ID: Ga0194061_1107216
• Source Dataset Name: Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 868
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila dulcis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 49.69
  • Long. (^o): -93.718

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043363	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194061_11072162	F043363	GGAGG	MSNSTWKNEKTKLVASWIINTPEICQSARNFANENSSAPILYRAWLKASEMQKVVTPDGISVLDPELHFGELSDVLWTLTV