Scaffold Ga0126371_10001099

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126371_10001099

Scaffold Ga0126371_10001099

Overview

Basic Information
Taxon OID	3300021560 Open in IMG/M
Scaffold ID	Ga0126371_10001099 Open in IMG/M
Source Dataset Name	Tropical forest soil microbial communities from Panama - MetaG Plot_4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	22683
Total Scaffold Genes	43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	27 (62.79%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location Name	Panama
Coordinates	Lat. (^o)	9.1086	Long. (^o)	-79.8436	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053711	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126371_100010995	F053711	GAG	MRGGVVNGRVQTEDVEGIIESVNANGLKIGGAWVNVSRFHPVTLPDAGARVRLKIDTKGYIVDLENLSPVGQTLSDKDERITRLAVLKAAAEFVGLWGQSREEVKSDHVLVLADRWLKWVEGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.