Scaffold Ga0224717_1123973

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224717_1123973

Scaffold Ga0224717_1123973

Overview

Basic Information
Taxon OID	3300021556 Open in IMG/M
Scaffold ID	Ga0224717_1123973 Open in IMG/M
Source Dataset Name	Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st36ic 200bp no Eukaryotes last
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	1604
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina 'control' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.828217	Long. (^o)	150.820517	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073151	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224717_11239732	F073151	AGAAG	MTSSNLFRYASGFEKRGHFAQNAKFWHFSSYHHFKAVRASDFILGLESHQAFCFTTPTFAAAGNFLSEVVAVKPKV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.