Basic Information | |
---|---|
Taxon OID | 3300021554 Open in IMG/M |
Scaffold ID | Ga0224713_1087526 Open in IMG/M |
Source Dataset Name | Marine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - St7is 200bp no Eukaryotes last |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 584 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upa-Upasina, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -0.940556 | Long. (o) | 150.816667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001416 | Metagenome / Metatranscriptome | 699 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224713_10875261 | F001416 | AGGAG | MPLVKKKLSVAAGATSDQVLAGTTYEYVDPGTRIVVAAAVDTAGTAAADTTMDFTVNNAEFAKNASVSTLVTGQPFGWNNTGYVMNDMVTTG |
⦗Top⦘ |