NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194048_10212934

Scaffold Ga0194048_10212934


Overview

Basic Information
Taxon OID3300021519 Open in IMG/M
Scaffold IDGa0194048_10212934 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)712
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003299Metagenome / Metatranscriptome495N
F003327Metagenome / Metatranscriptome494Y
F004234Metagenome / Metatranscriptome447Y

Sequences

Protein IDFamilyRBSSequence
Ga0194048_102129341F003299N/AMKIYKVVYKTFDYWNGPIKLVTRIIEAYDADHVKQLIQKNDDLILLIEEV
Ga0194048_102129342F003327N/AMTEFTQLAREVQDTIANGEYTHQKYLQFREWYFQNYEGSKRNANRDFAMFDLMYGLDVPIKNNDNEDI
Ga0194048_102129343F004234N/AICNIINLIFIHFFRTYIMNFIDLYKNGNQYISNWTTDYDSDVYIAGTIEPFTYNATETDDGDMSLFILSDANLNLLKSKL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.