NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194048_10119176

Scaffold Ga0194048_10119176


Overview

Basic Information
Taxon OID3300021519 Open in IMG/M
Scaffold IDGa0194048_10119176 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1006
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009143Metagenome / Metatranscriptome322Y
F019325Metagenome / Metatranscriptome230Y
F024319Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0194048_101191761F009143AGGAGMMTKWDTIQADVADAYTYLDEEEMYNKALAEGAIDLDADEYDEDELSKSLTLDWND
Ga0194048_101191763F019325AGGAGMTTLTETLYSTIVHDFHNGGVKSSYGLDTYTRKALLRALLSSKGCECINCL
Ga0194048_101191764F024319AGGMTNRIWESRNDYLVESDAKRLGYVACSAGCGRVTAWSLCTMCGGNYAEHNLVGKESK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.