NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194048_10028169

Scaffold Ga0194048_10028169


Overview

Basic Information
Taxon OID3300021519 Open in IMG/M
Scaffold IDGa0194048_10028169 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2381
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011394Metagenome / Metatranscriptome291Y
F072349Metagenome / Metatranscriptome121Y
F105192Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0194048_1002816910F105192N/AMDISTTQIIITLIAAAISGAFTAQINNIRAKKERLARIEDKAHDQLLLELKDLEIKLYKLEKDLNEWKDKYFEALQELIRVKAELEGTLLKLSHIG
Ga0194048_100281698F011394AGGAMFIDKNKDHFKYGINEWTGEPNKPTFYNKEMALKIREIKKPTPTLEMDIVKYPEFLAIRLYENNFAQYDGSMRVRVIEYVEMVKNILESYGVRVELEGKPGGKNHG
Ga0194048_100281699F072349AGGAGGMDKVLCYSCNKSKNELSAKKSVLLSINLLLCKSCAENKLEPRWIVILAGRQYGSDHVKEHIAKKKYVGVDITASELLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.