Scaffold Ga0224723_1133024

Overview

Basic Information

• Taxon OID: 3300021517
• Scaffold ID: Ga0224723_1133024
• Source Dataset Name: Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 761
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia

Source Dataset Sampling Location

• Location Name: Indonesia: South Sulawesi
• Coordinates
  • Lat. (^o): -2.651
  • Long. (^o): 121.2318
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039540	Metagenome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224723_11330242	F039540	N/A	MMAIVKSDAVNRCIREAAQKAAAPGGLSKKILERFLRTGDRTWNGAGSGRFTLSQFKEDEEYTRASKTALRTLLSQLGDLLPQEARAAPSVSPEAIRRRIEPMVHGLVLADQREAALREIVAKTFVLNFQGANAAIEAELSTCFTGSAWRILWVFFEDHGLKPKSVIVGCDGIAGDFAHVRWSAYETKDPYSDVVVHEGAHMLH