NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190303_1037925

Scaffold Ga0190303_1037925


Overview

Basic Information
Taxon OID3300021512 Open in IMG/M
Scaffold IDGa0190303_1037925 Open in IMG/M
Source Dataset NameHydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-0-1_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1430
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5931Alt. (m)Depth (m)1999
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038301Metagenome / Metatranscriptome166N

Sequences

Protein IDFamilyRBSSequence
Ga0190303_10379251F038301N/AITNLSMVTNIAIALAISLTGQVETKLCNLKCTGHTKDVVIDNSKDITQNPKYMDGLESGYILLCNGEAEGFTNHNTGEISCDGSNHEGGDGKKGECYVCY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.