Scaffold Ga0222621_1001286

Overview

Basic Information

• Taxon OID: 3300021510
• Scaffold ID: Ga0222621_1001286
• Source Dataset Name: Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3602
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9201
  • Long. (^o): -106.9487

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008659	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222621_10012865	F008659	N/A	VLSTQAALLSRRLRLAFLADNKWRREECARNTLPRAVILKRFATDLRVLLRAIGLGMRRE