Scaffold Ga0190304_1009725

Overview

Basic Information

• Taxon OID: 3300021509
• Scaffold ID: Ga0190304_1009725
• Source Dataset Name: Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-1--2_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3311
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin
• Coordinates
  • Lat. (^o): 27.0114
  • Long. (^o): -110.5931
  • Depth (m): 1999

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035145	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190304_10097257	F035145	N/A	LSEFMRRDYNLKTIITEECCELKKIEVICFTETTSFPLLTLTCSKKTGDFVLVIERRFIAHRSTLKALIEALEKVREVIAKSA