NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210410_10479334

Scaffold Ga0210410_10479334


Overview

Basic Information
Taxon OID3300021479 Open in IMG/M
Scaffold IDGa0210410_10479334 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1112
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F002850Metagenome / Metatranscriptome526Y
F006905Metagenome / Metatranscriptome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0210410_104793341F006905N/APEEVPDRNREVNCFLPPLASAIHAIMKELQAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFEGICRRPGGKIT
Ga0210410_104793342F001698AGGAGMTGVVNDIEALAEFRAHLMRFNHDLAENFATIQGHWRELGEIWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLSGYLETGAGAGLGVGRPEPARGSRRGTGRGDGPA
Ga0210410_104793343F002850AGGGGGVTGIHADIDALHGLHQALVRYRHAQRDVTARGGDQLTATRASLEAKASRWRAQLELGQADFSACQDRAARAAADDPAGGTVDCSGYARAVEQSGERLDQIRRWQQRIDAEASEFHVTASRFADLLENDLPRMEEHLVAIIASLEAARRVQAPAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.