NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210410_10006228

Scaffold Ga0210410_10006228


Overview

Basic Information
Taxon OID3300021479 Open in IMG/M
Scaffold IDGa0210410_10006228 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10386
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000512Metagenome / Metatranscriptome1064Y
F006229Metagenome / Metatranscriptome378Y
F016183Metagenome / Metatranscriptome249Y

Sequences

Protein IDFamilyRBSSequence
Ga0210410_100062281F016183GGAMTTIGSLDAPIEIFGGLVSDMAPADLPHGVSPDCQDVVFSSGGVATRPGLQTLLGPLAGNPTVNYVKSYITPNGTLRTIAQDANGNLYKETTPGTLSQIASGLTPNSYANSTTLFGREYLATSDGMTGND
Ga0210410_100062282F006229GAGGMNKQSDVVSLVNISTQKWPPRHRTYFGSLVIQSPDAGAAYAVTPVRSCTSVMDLGDKRTMEIRLSAQEIAEDLVREINGDSGEGSFHGVFVATGPEPTKEELEGARKKLEAFQLRLVETADLEWERSHNMMFITDLERRAARELGLEKPWLYDPKPLADCPACGEKIKPGVAVCRTCGAILDREKAAKFGLAEREEKGGEAGKVVDKKPTREK
Ga0210410_100062288F000512N/AMIEVLRERRETPESVARRLCLAGGVNRYGEANYRVVWGWNRLGWIGGKFEDRDARGDLIREVVELRWEPKYPQVNRWHVERWVPAEAYGSPRAWYAQTLEREGGKSVAALGPYPERGEYEHCFTLQGPRGEFVQLTPTIAEYVARAIEWARGRNRATQRAKLYEREALEERAYEAWAFEVMDDGSPAFGGKPMVTVG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.