| Basic Information | |
|---|---|
| Taxon OID | 3300021476 Open in IMG/M |
| Scaffold ID | Ga0187846_10031008 Open in IMG/M |
| Source Dataset Name | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2427 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: State of Minas Gerais | |||||||
| Coordinates | Lat. (o) | -19.8881 | Long. (o) | -43.6761 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055949 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187846_100310081 | F055949 | GAGG | MFGRHAAFRTYETPDHTEALVWYGEFRSEEESKLATKLSLKEHRITGTEHVKDLNGHVIGDRIVAAPKEEKKAFMVIRTHGLNYWIIQSISLAVAMQVDGLVEPPPPMPAFAENPSSCDRSIELLSKQQRLSEEEQKKVHHVRGMVAIVISADGDVVGAKVISARRPRDGNEAGLSSTEAVDVLLSQARSMKFKSRPGCGDFRYDVSF |
| ⦗Top⦘ |