Scaffold Ga0187846_10028224

Overview

Basic Information

• Taxon OID: 3300021476
• Scaffold ID: Ga0187846_10028224
• Source Dataset Name: Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2560
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Brazil: State of Minas Gerais
• Coordinates
  • Lat. (^o): -19.8881
  • Long. (^o): -43.6761

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019284	Metagenome / Metatranscriptome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187846_100282242	F019284	GAGG	MRLVPAAFVCLAALSLQAAPIPKKAVPASLGLAPVVELVGQGCSLGWHRGHWQDPSGEWHWGHCSPSWR