Scaffold Ga0182009_10480232

Overview

Basic Information

• Taxon OID: 3300021445
• Scaffold ID: Ga0182009_10480232
• Source Dataset Name: Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 653
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1613
  • Long. (^o): -96.6752

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093651	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182009_104802321	F093651	N/A	AITLACATRTASNDDLRVAHHARNSNVISREELQDPAVAPNDAMTAIRLLRPAFFLTRGPLSIKNTTAGQLQISQDYGPLQKSSALSTIDTRSLVEVRYLNATDAQARFGINANGGPVLVLLTSTQ