| Basic Information | |
|---|---|
| Taxon OID | 3300021445 Open in IMG/M |
| Scaffold ID | Ga0182009_10272928 Open in IMG/M |
| Source Dataset Name | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 845 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Nebraska | |||||||
| Coordinates | Lat. (o) | 41.1613 | Long. (o) | -96.6752 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016343 | Metagenome | 248 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182009_102729281 | F016343 | AGG | MKSVLLAIDWSLVRVGLVILGMGVFTVIMETVVMVLFKFDSFGKSLIYSIMANIGSLLLGILLFLIFNKTEFGVSQRAELLILFSVTSLFEAWLIRLLNPRMSWGRIILTSFVMNLLSFISLYLIFTKFLASFFSLXFVTVKEPKRGKIILTYRKATYNG |
| ⦗Top⦘ |