NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206685_10013428

Scaffold Ga0206685_10013428


Overview

Basic Information
Taxon OID3300021442 Open in IMG/M
Scaffold IDGa0206685_10013428 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2559
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Thioglobus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026127Metagenome / Metatranscriptome199Y
F036423Metagenome / Metatranscriptome170N
F047120Metagenome / Metatranscriptome150N

Sequences

Protein IDFamilyRBSSequence
Ga0206685_100134281F036423N/AFEARVAVEDISATEMVLGFVDTDVTSGVVNITDGLYFSNFSDPDSITAGTSLYLHCEKNGTITSSDALVDPYTGSTFVIEDGALQAASATQLATPSNSFIAGFNIVPKGSNGNVNTAVIQAYLGPVGKQPLPVASIATTNLPDDLALGLMMGTKNNTTTAAIMWVDYVKAISSRSFGSSTTK
Ga0206685_100134282F047120GGAGMFDVKTKQLTASGQVTTKVSAGSNTLSAPARVLGLTVQCGATEGKIDLVDDGASGTVKFTQVTPAIKAGAEDLLQFDFPEMGLKFDTDLYVYFNHATKVNVIYG
Ga0206685_100134284F026127GAGMFSLAIIGALNIMGCGIYEGMSMKPHKTSVTTTYGQDEVDKANDSKDQTKDSMQIIVKQEFLWKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.