NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213879_10044404

Scaffold Ga0213879_10044404


Overview

Basic Information
Taxon OID3300021439 Open in IMG/M
Scaffold IDGa0213879_10044404 Open in IMG/M
Source Dataset NameVellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1159
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.28Long. (o)-43.5919Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000936Metagenome / Metatranscriptome828Y
F005182Metagenome / Metatranscriptome409Y

Sequences

Protein IDFamilyRBSSequence
Ga0213879_100444041F005182GAGMVRLSRLNGRTQMPKTAMFGFAPALIAIGFGVWAVLPANTPASPSLGQGIEPLQIMVNAKELPTVEYADYTFVFPD
Ga0213879_100444042F000936GAGGMNHVQKYLAQANRQIAELTVQIARQRVIVKDALDTGQRSEMAESLVDALEGSLRIFEKHRIFLLSCSVNRPSKRVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.