| Basic Information | |
|---|---|
| Taxon OID | 3300021439 Open in IMG/M |
| Scaffold ID | Ga0213879_10040976 Open in IMG/M |
| Source Dataset Name | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1198 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: Minas Gerais | |||||||
| Coordinates | Lat. (o) | -19.28 | Long. (o) | -43.5919 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020988 | Metagenome / Metatranscriptome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213879_100409761 | F020988 | N/A | MYGTRFRLGGSCVLAIILVVGSLQANLYAQRAAKLSPKVMAVINGPVLELKDDDPPLLRLKKERFNAALNEAKARYDLYNRGLTRIPELIDVGERLFAAEADLYDDPQKKVDALQRQLDVYTEAETNLQKQVKDGLATQADLERLR |
| ⦗Top⦘ |