NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213920_1016843

Scaffold Ga0213920_1016843


Overview

Basic Information
Taxon OID3300021438 Open in IMG/M
Scaffold IDGa0213920_1016843 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1904
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9255Long. (o)-83.5226Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056554Metagenome / Metatranscriptome137Y
F098561Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0213920_10168432F056554AGGMSVTLGKDASNSPPFGTGIISATYTEECETIDVSNRSNVGGSSGAPGRKVAKAGFTVKTWEIECHDPSSLITSLEAAGSSWSVMSVTENIGIEGAVTFNVTAKEFT
Ga0213920_10168433F098561AGGAMPITLGKDCSISFGGTVTGVRNVTLTESARTIEVNRFGSRYAATYNTGYECTVSVELNNSTGLSDVFTKMHTGGTFTVSGGAGGFTFLAVMTSITETDPIDGVATFVLEGRMTDPALTR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.