Scaffold Ga0210384_10106302

Overview

Basic Information

• Taxon OID: 3300021432
• Scaffold ID: Ga0210384_10106302
• Source Dataset Name: Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2517
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location

• Location Name: USA: Massachusetts
• Coordinates
  • Lat. (^o): 42.481016
  • Long. (^o): -72.178343

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052914	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210384_101063023	F052914	AGGAGG	MLRKFLCAASLAGFVLAGIAAHARPLPQQESQPKQRNDQNKTTSGKVTDIAGDKKSFTLEISDGNAKHTMQFVLDGNTQVQGKVSVGTDATVEFQPAPDGKNLAVVITPRTSPPPSK