NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210384_10057560

Scaffold Ga0210384_10057560


Overview

Basic Information
Taxon OID3300021432 Open in IMG/M
Scaffold IDGa0210384_10057560 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3516
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000165Metagenome / Metatranscriptome1824Y
F007395Metagenome / Metatranscriptome352Y
F045239Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0210384_100575602F007395AGGMARPVRVRPSEPRDDHFEDLPISVNASKDGIYFVTRLKSYYKGMRVFVTFPFSSPHDPMNCEYVAQVVRVEELPNEKFGVAVHLQMSVNYG
Ga0210384_100575604F000165GGAGMMLTVTKKPPLVEDLRNHSQEQIAELRLLLTSGAPSRPDPRRPGFYEIEGHSDTYYVFKYPTGTKVLLLGAWERESDPVATLVACSCPAA
Ga0210384_100575607F045239AGGAMAETANYSHLARHATVATRRTLTWVEEPRFQGCGCSECAWVFNPSGPPAGKSLNEMMESYKRLRDKEFAAHVCVEHPRVKRAKI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.