| Basic Information | |
|---|---|
| Taxon OID | 3300021431 Open in IMG/M |
| Scaffold ID | Ga0224423_10366725 Open in IMG/M |
| Source Dataset Name | Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1325 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Zealand | |||||||
| Coordinates | Lat. (o) | -42.26 | Long. (o) | 171.6 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029959 | Metagenome / Metatranscriptome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224423_103667253 | F029959 | N/A | MYKPIDPVKSLGVDDKTTSSLITCAYNYYLTKEIDKKICSKKEYAKLISCFVRFFRSLNSSRQSDDDILHYLKTEGLKGKAESLTLVTKYITEIREYQSKKILFSSPDLLNTLNPINNKTYNRGRNIRNLVNFDYKIDVVISSNYHNKLLLPQIYLIFSLDDGEIIKVKVDLRIFNEFRKCLGMHVKKILFNEGISQIK |
| ⦗Top⦘ |