Scaffold Ga0224423_10004247

Overview

Basic Information

• Taxon OID: 3300021431
• Scaffold ID: Ga0224423_10004247
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 18852
• Total Scaffold Genes: 34
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (23.53%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053097	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224423_100042477	F053097	N/A	MFDIKGDKIQLSPEDLAIPPFKDHYNNAKDKQLALKEIEYVVWLHKWNTPYEAYPQKERPRVVAKDVFKDEHYIPSEEVKSLAQRFIEF