Scaffold Ga0224482_10188974

Overview

Basic Information

• Taxon OID: 3300021426
• Scaffold ID: Ga0224482_10188974
• Source Dataset Name: Sheep rumen microbial communities from New Zealand - Tag 1435 SPADES assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1824
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location

• Location Name: New Zealand
• Coordinates
  • Lat. (^o): -42.26
  • Long. (^o): 171.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044826	Metagenome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224482_101889743	F044826	GGAGG	MSITTRSIRAYRRLSGAVEAELRVEVNGETPTAWQIQGLRTKAPFAIIDGHRYDLQTHEIFALRKAISEVG