Scaffold Ga0194117_10017618

Overview

Basic Information

• Taxon OID: 3300021424
• Scaffold ID: Ga0194117_10017618
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4937
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae → unclassified Mimiviridae → Yellowstone lake mimivirus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -5.7366
  • Long. (^o): 29.9194
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079611	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194117_100176182	F079611	N/A	METRENEEKYISISKQNIDNFLTRYEYRKAFGLLILFLERLDDKDKVDVIDYYSKNMKQLGIFKNTYVVDK