NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193709_1000004

Scaffold Ga0193709_1000004


Overview

Basic Information
Taxon OID3300021411 Open in IMG/M
Scaffold IDGa0193709_1000004 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)144018
Total Scaffold Genes121 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)59 (48.76%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9821Long. (o)-107.0102Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004136Metagenome / Metatranscriptome451Y
F019990Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0193709_1000004119F004136GAGMKSLTVHEAEGQLAKLIAEAYRGQTIVLTDGDKRVTLEPGGLDLENDTPELEAELLKAVNGPHAPFQEAELRDIAERALREHHERRSK
Ga0193709_100000481F019990AGCAGMKTKIELWDESILDVEDYQVERALTNAALDAIHRARQFGTDFVIEEDGKTKSLRPNETAPYEKRFLEDLDRINRKIAELQAQQPNALELNESADKPKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.