NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213875_10000456

Scaffold Ga0213875_10000456


Overview

Basic Information
Taxon OID3300021388 Open in IMG/M
Scaffold IDGa0213875_10000456 Open in IMG/M
Source Dataset NameRoot-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35369
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (72.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.2822Long. (o)-43.5936Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075142Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0213875_1000045619F075142GGAMAISLDATEYMFQGDGITASYYPNGAGGPIIVGHQELFFSYQDSHLSKTYGKADVDVQFIDNVGALVSVILVKSEIAGGPVTTFSVLVPAIGVTLTSGPQTFKTRGITTVQAATLVAREVFPALQTYKVEHLDGTASVFDVAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.