Basic Information | |
---|---|
Taxon OID | 3300021384 Open in IMG/M |
Scaffold ID | Ga0213876_10773823 Open in IMG/M |
Source Dataset Name | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: Minas Gerais | |||||||
Coordinates | Lat. (o) | -19.2822 | Long. (o) | -43.5936 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024623 | Metagenome / Metatranscriptome | 205 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213876_107738231 | F024623 | N/A | EEGAYLNGYVTDEQRSRRPIFNATLWAVSSWLFFRVARSLHIDLDMLVARALKNSQLAYGET |
⦗Top⦘ |