| Basic Information | |
|---|---|
| Taxon OID | 3300021384 Open in IMG/M |
| Scaffold ID | Ga0213876_10133534 Open in IMG/M |
| Source Dataset Name | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1320 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: Minas Gerais | |||||||
| Coordinates | Lat. (o) | -19.2822 | Long. (o) | -43.5936 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016560 | Metagenome / Metatranscriptome | 246 | Y |
| F089270 | Metagenome / Metatranscriptome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213876_101335341 | F089270 | AGTAG | MARLVPHAETTAANLARVLRLHTLPSTPWEPHQRAVAARRLLEELGVRCDESAVLHDLKGFLLSSPRGSELVVSRELNDEQRLEVYAHLIAHALL |
| Ga0213876_101335342 | F016560 | GGA | MSDRDEVQVARWSAIKGRVGASLRELRLSDVGSAGGRSQARLAGELEELGYHVTQSMVSRYEQGLLEAPLTLERMVGWALCCEALSSLAFRELLSLAGYYLPWNDADLQSFDDLLRSYRRLSLADQIAVRARLLWHILGIEVSESSD |
| ⦗Top⦘ |