Scaffold Ga0194130_10280177

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194130_10280177

Scaffold Ga0194130_10280177

Overview

Basic Information
Taxon OID	3300021376 Open in IMG/M
Scaffold ID	Ga0194130_10280177 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	936
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location Name	Tanzania: Lake Tanganyika
Coordinates	Lat. (^o)	-4.8369	Long. (^o)	29.6087	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083729	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194130_102801771	F083729	GGCGG	MIPALLASLLATPLGWGIVDGTQYKCDRMQVYSTETDTKWVVCADKIYEYKVIDGKRQPP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.