NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213869_10051960

Scaffold Ga0213869_10051960


Overview

Basic Information
Taxon OID3300021375 Open in IMG/M
Scaffold IDGa0213869_10051960 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2130
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005590Metagenome / Metatranscriptome395N
F005843Metagenome / Metatranscriptome388Y
F009460Metagenome / Metatranscriptome317N

Sequences

Protein IDFamilyRBSSequence
Ga0213869_100519601F005590GGAGVTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEVLRKEIKRCLSRHNELSVGDLCSMIEQDAVHIDIGLKTMRERRTIVKTSF
Ga0213869_100519602F009460AGGAGMAKWDLSKLENSASVGAHIDEDSSTPTQPTPQMLVMSIRRKADIMRMDAGRGPERLTIKQRAEEIMALCEMLERRL
Ga0213869_100519603F005843AGGAGGMTLAEPVFMAFVIFSSPDECEAFAEYYDLARIFEPQCVEMGGEADYRRPWPDVRPQPRPTQENNNG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.