NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213865_10035731

Scaffold Ga0213865_10035731


Overview

Basic Information
Taxon OID3300021373 Open in IMG/M
Scaffold IDGa0213865_10035731 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2779
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049008Metagenome / Metatranscriptome147Y
F088927Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0213865_100357312F088927GAGMVNLNLADHNTKVLNETREDPTQQLWRSVLRQAFEDAFLGAKLHLCDYEKRDARSFVSERSTNFDYVCELAGLSPDYVWDKLQKFRKEKYVWKNDLQRVQW
Ga0213865_100357319F049008AGGMSRNNQITQLTRECDALAARFWRLEASGRGQGYLEWLQKVRQVSEIIEKNRPETFYFFGNELKSANSNASRRSARKKVEKSREK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.