Scaffold Ga0213863_10015281

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213863_10015281

Scaffold Ga0213863_10015281

Overview

Basic Information
Taxon OID	3300021371 Open in IMG/M
Scaffold ID	Ga0213863_10015281 Open in IMG/M
Source Dataset Name	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4573
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (69.23%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	34.7181	Long. (^o)	-76.6707	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072342	Metagenome / Metatranscriptome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0213863_100152819	F072342	GAGG	MPKDYHQIRIKKQLKTKKVLKQMSAEQREAISEIQESVAQCINMIKECNDLYMSDISKLELSYHNLIWAFEVDDV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.