NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206123_10164174

Scaffold Ga0206123_10164174


Overview

Basic Information
Taxon OID3300021365 Open in IMG/M
Scaffold IDGa0206123_10164174 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1009
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017285Metagenome241Y

Sequences

Protein IDFamilyRBSSequence
Ga0206123_101641741F017285AGGAGMSWSGTVTCSHCYQRGHNKRKCPTLTTQIKDKYEGNTSMAVQERAAGNENDAEWYDTRAEHYRQLYLKRTKVDLATGEKVTNKAAKTARMKNVTCGYCKERGHTRRTCQHVKHDKQIFVEETRRMRIAALYLARETGIGLGSMIPIRSTGYDSDGQWSSDILTLRYVQSVLWDECHANRTALIVKHIDARKLGAANQSAYTSRDQLTKLVQANSAALRYADAEGQDLPISSLVPTLDPPKGWLQPTEQSLKVAIKQAFPTSGNDYAKSRNYEYAYPSGITKEIIEALGLQEHYST

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.