Basic Information | |
---|---|
Taxon OID | 3300021361 Open in IMG/M |
Scaffold ID | Ga0213872_10166512 Open in IMG/M |
Source Dataset Name | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 957 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: Minas Gerais | |||||||
Coordinates | Lat. (o) | -19.2822 | Long. (o) | -43.5936 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017502 | Metagenome / Metatranscriptome | 240 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213872_101665122 | F017502 | AGGAG | MDKQAWSRQPIVVAAAVVLAAAMPLTMKAHSYPFGAGYQVTMGAGGGSAVDKADPTDDGAIIIECVGFDGRMMPYANEADTASTLHAVSMPQHRLGPSKCWSGEHKRSAAGGGGVGNLMTVF |
⦗Top⦘ |