Scaffold Ga0213870_1069460

Overview

Basic Information

• Taxon OID: 3300021357
• Scaffold ID: Ga0213870_1069460
• Source Dataset Name: Freshwater microbial communities from subterranean cave lake in Wind Cave National Park, South Dakota, United States - WICALVC2017
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1124
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: South Dakota
• Coordinates
  • Lat. (^o): 43.5566
  • Long. (^o): -103.4781
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002514	Metagenome / Metatranscriptome	552	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213870_10694602	F002514	N/A	MDERTGLPAVGVVGLRDRDVMNLLDQLELYTLKAGGGKVTQRDYWLFVYNIMKSGELATRSMGKHLHEKLRGLGVNPP