 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300021356 Open in IMG/M |
| Scaffold ID | Ga0213858_10003754 Open in IMG/M |
| Source Dataset Name | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7167 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 34.7181 | Long. (o) | -76.6707 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033639 | Metagenome / Metatranscriptome | 177 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213858_100037546 | F033639 | N/A | TISEVLIGTGVLYYADRTTSSLVFPADNSGAWENPTTLSVPFSEVGYSEDGWTLEVDKTFEDVMVAEEVDPIKTLKSAQEVRLTGELAQAGIDKLQIAMGGGVKAEDTITATTTQTSGDDFDTGYDSYIPPLSDTFTEYAMVLHTDGPAGADRQFHIPRAVNVGSFAMSHQKAPAKVSLATEFKLLVPDSTLNVGSSGGAYYLFRVIDNTNDTDELDIN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |