Scaffold Ga0206695_1739991

Overview

Basic Information

• Taxon OID: 3300021348
• Scaffold ID: Ga0206695_1739991
• Source Dataset Name: Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 911
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.6907
  • Long. (^o): -122.3448
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103312	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0206695_17399912	F103312	N/A	MRMGSEHVGFLGELDLSEFLSLGHHVLILDTHNTTTPGSSEGDVLVEVSGEVALEVGEVGKVFLSDIGEGNAGSGLGVAELSESCFTSDEAEWDVVLSAESWQENHDLEWVNIVGHDDELGFAFLDESGDVVETEFEVLWLWSGVSSSGTLSGFSFSDESSFLLGSGLWGVLGEELEELGGLVLVDGLLELVESWW