NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213862_10158658

Scaffold Ga0213862_10158658


Overview

Basic Information
Taxon OID3300021347 Open in IMG/M
Scaffold IDGa0213862_10158658 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099426Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0213862_101586582F099426GGAGMPRRKITRRPLPLFEIITAKKAPPRKTTPKSFWRDLVGGMTAGDWFILDECDKDRVGAGISKFARGRYSLYQHPELEGKYVFTITK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.