NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213862_10102435

Scaffold Ga0213862_10102435


Overview

Basic Information
Taxon OID3300021347 Open in IMG/M
Scaffold IDGa0213862_10102435 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1006
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012861Metagenome276Y
F029238Metagenome / Metatranscriptome189N

Sequences

Protein IDFamilyRBSSequence
Ga0213862_101024351F012861GAGMYDLEKYKKIKEKLNDLEEIDFTAKEYHLIFEMAGFDLLTNSEMRTLILAFCEKLNPELSPREYDNIKDHHVDLPE
Ga0213862_101024354F029238N/AMKLRPQTEEKSKGGMKERRHICLKNVGNIPTVNIKGKKYSTVNERHKHLLEYFP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.