Scaffold Ga0213867_1170131

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213867_1170131

Scaffold Ga0213867_1170131

Overview

Basic Information
Taxon OID	3300021335 Open in IMG/M
Scaffold ID	Ga0213867_1170131 Open in IMG/M
Source Dataset Name	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	738
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	34.7181	Long. (^o)	-76.6707	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002512	Metagenome / Metatranscriptome	553	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213867_11701312	F002512	GAGG	MSKEFTDTEIAELNKEFDKGNAFTKWKFMQTEEFKRMPDAVRYTVEKECLLHYFNIITDGMSDWKGPIKAMIPISLLNPMRAAVEYFTGTELMVLEQVDTEFKVFAKGYYMMGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.