NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213867_1012744

Scaffold Ga0213867_1012744


Overview

Basic Information
Taxon OID3300021335 Open in IMG/M
Scaffold IDGa0213867_1012744 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3527
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014683Metagenome / Metatranscriptome261Y
F037097Metagenome / Metatranscriptome168N
F049027Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0213867_10127441F049027N/ANAQWKIDLEVPRWGRDTETEPCNIKVAKYMRSAMAEAIIEMEAIQKQIPLMEKEFARGQAERKAEEDRKAAEKQAKIDADKPVGYKLAKTICDEMVKQARDTKEDSQEIVFKTRGDHREMSMRCIYTFTGLTLFNIGYGRVSRKDAVQKLADAWLASVDTGDIKDSIPDARLAGFMMGGK
Ga0213867_10127442F037097AGGAGMKAFEQAVEAINRIDDPSEIRDLFEAIRLRQTFLGNKTIRKLAVGDTVSYEGRNGYTKGRVTKINRKYVVVETPNGSWRVPATMLTKEADYA
Ga0213867_10127447F014683AGGAGGLSETVEAKRRFTYTLSIECASEGNADLDAVENILDLHFQDLVMDDTFVNELDEGQAVTIQVVPNFGKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.