NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213867_1002530

Scaffold Ga0213867_1002530


Overview

Basic Information
Taxon OID3300021335 Open in IMG/M
Scaffold IDGa0213867_1002530 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8044
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040916Metagenome161Y
F066693Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0213867_100253011F040916AGGMRSQEFVTELVSGTENKEHLINRANKVADICATMGDRPLLYRQVRNTGMYGDKALIIKATPRSIYKDEKLLGTGNLVQPHVLNKLGIEHPVFSTMDPHPGTQGKFGANYFMVPLGAYKIYSSPQVNDLGSDTSYNDKDRKMFAPPSDEEVAKFDAVADTYKEGWPSAGFPNEVILDCEQYYMINVGEFVKKYAGEKARQMYTRDPDKFSKIKNDINKELLTSRFKTYNDMAWYLRNPVTNLLKA
Ga0213867_10025302F066693AGGMKLSCSTLYISHPTAIRHGPLGVNKQSRQSIVEHFLKLKDESQPTNESWKTGHDIHLDHDILNPLLDQIHLWYCHNVVGPRGPKFITDQIWHDTGNLDIDAEVWFQESLPGQGCPQHEHGTLSRCSWVYYLDVGESNNPLTFVEMQESKNEIFPVDEVNLPVYNDMVVMFPSTIHHKVYPVNTTRYILAGNINDITYREN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.