NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213867_1001085

Scaffold Ga0213867_1001085


Overview

Basic Information
Taxon OID3300021335 Open in IMG/M
Scaffold IDGa0213867_1001085 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12116
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002902Metagenome / Metatranscriptome522Y
F044515Metagenome / Metatranscriptome154Y
F047972Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0213867_100108511F047972GAGMRFVEFSPNMMVDRYVIVLKNLIGRASAKKVPAKMNWAGLNRILKSNDASLMADYEMFKAMYDTSPAIQNLVKNFNADGIELNVPGAQDDETPADGATDAQAAVDATAASAAPQQLAQQ
Ga0213867_100108516F044515N/AMVFGFLLSLYGLHIEAHNIVYVGVSIMAGVCAVWWFWVMFVIKDMFDRVEKAADKMIEVKEELGGIKGLIRKLFQRNDDK
Ga0213867_100108518F002902N/AAVTPGNGIAGRTRIINLNKTNMTQAELDAALEYLAAGDVAGTNDAHTIAGVQPLTESGVFTSGTTDDVQVAIQGTGAFTAASNFGIGTTGVTSSLLAEFSGISG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.