Scaffold Ga0210324_1376167

Overview

Basic Information

• Taxon OID: 3300021333
• Scaffold ID: Ga0210324_1376167
• Source Dataset Name: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 712
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.208
  • Long. (^o): -123.693
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000344	Metagenome / Metatranscriptome	1257	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210324_13761671	F000344	AGGA	MRPRHPHAAESGVGKHTARESESAQACATGKERVA