Scaffold Ga0210295_1210046

Overview

Basic Information

• Taxon OID: 3300021323
• Scaffold ID: Ga0210295_1210046
• Source Dataset Name: Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 539
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 46.249
  • Long. (^o): -123.986
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055402	Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210295_12100461	F055402	N/A	MKPSHQSDVTYSKNTLFCWSFYTQDTGSTKKTYELDLLRTQLFLGASIFGCEEYRVYSDAAEWISPGDDGVKTIQVFEEPGLPFHFAKRKRVGKWVNSNSFIQAWKKIKEEGAWAKWDWNVKVDIDAVFLPIRLRQYLGKVEVTDNGIYLETCKYVNFGYFGSC